PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.XI6IE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 429aa    MW: 48276.5 Da    PI: 8.6644
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.XI6IEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l++ v++ G+g+W++I +   ++R++k+c++rw ++l
      Aradu.XI6IE 21 KGPWTPREDAILIEQVEKCGKGNWSLIRKNSELRRSGKSCRLRWSNHL 68
                     79*******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.2281672IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-221871IPR009057Homeodomain-like
SMARTSM007172.4E-142070IPR001005SANT/Myb domain
SuperFamilySSF466899.8E-232298IPR009057Homeodomain-like
CDDcd001676.59E-112368No hitNo description
PfamPF139214.6E-152483No hitNo description
PROSITE profilePS500905.27369100IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.0E-1572105IPR009057Homeodomain-like
SMARTSM007171.973120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-15191208IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MISNNNKNNE DGESWRDDLR KGPWTPREDA ILIEQVEKCG KGNWSLIRKN SELRRSGKSC  60
RLRWSNHLNP DLKKGPFSEK EEKTIDDLHA KFGNKWALMA TKKKKTTGAT EKCHRTSLRV  120
VVEKQSNRGA FSWGKVTLRL VSGVSGWVVP QPHWMPSIFI VHYMNACPNF EKCMFAGPGL  180
GDSSYGPVSG RSDNDIKNFW NSRMKKRLRE YPPQITVQQA QHFSSSPFYS VLASCYPKNN  240
LSVELPSNIS AANPPPNHNQ KQPNQNDSSF SSSSSFSYTN NNASFVLPLT HVSPYCKSSG  300
LLNDVVMEGN ALCRKGKSKM DATIVIGREE EELADKRKII EEPPLPPVGT SKEEEIATII  360
ATQSSSHQLI STEKNDNGGC NNNKEALNNS MPQMDDELLS ILKNCPIYSP VRKWYKVDDD  420
EDSLMMMEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-18181174102B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935995.11e-166PREDICTED: myb-related protein 340-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-30myb domain protein 101